PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.6677s0007.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 258aa    MW: 30325.3 Da    PI: 8.5836
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.6677s0007.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.81.8e-30959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krienk+nrqvtfskRr+g+lKKA+E+SvLCdaev++i+fs++gkl+eyss
  Cagra.6677s0007.1.p  9 KRIENKINRQVTFSKRRAGLLKKAQEISVLCDAEVSLIVFSHKGKLFEYSS 59
                         79***********************************************96 PP

2K-box103.13.6e-34831767100
                K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                           + +++ + +++ e+++Lk++ie L+r+qRh+lGedLe +slkeLq+LeqqL+++lk+iRs+Kn+l++e++++l +keke+q+en +L+k
  Cagra.6677s0007.1.p  83 PDSHANAQPNWSMEHSRLKAKIELLERNQRHYLGEDLEAMSLKELQNLEQQLDTALKHIRSRKNQLMYESLNHLHRKEKEIQDENSMLTK 172
                          336777788********************************************************************************* PP

                K-box  97 klee 100
                          +++e
  Cagra.6677s0007.1.p 173 QIKE 176
                          *987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.113161IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.62E-34286IPR002100Transcription factor, MADS-box
CDDcd002655.56E-42279No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-30323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-303859IPR002100Transcription factor, MADS-box
PfamPF014861.1E-2985174IPR002487Transcription factor, K-box
PROSITE profilePS5129716.81590180IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FSKRRAGLLK KAQEISVLCD AEVSLIVFSH KGKLFEYSSE  60
SCMEKVLERY ERYSYAERQL TAPDSHANAQ PNWSMEHSRL KAKIELLERN QRHYLGEDLE  120
AMSLKELQNL EQQLDTALKH IRSRKNQLMY ESLNHLHRKE KEIQDENSML TKQIKERENI  180
LRTQQNQWEQ QNRNHDVPPQ PQPQQFQPQH PYMISHQTSP FLNMGGMYQG ENQTAMRNNL  240
DLTLEPVYNC NLGCYAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-20174173Myocyte-specific enhancer factor 2B
1tqe_Q2e-20174173Myocyte-specific enhancer factor 2B
1tqe_R2e-20174173Myocyte-specific enhancer factor 2B
1tqe_S2e-20174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934770.0AB493477.1 Arabidopsis thaliana At1g26310 mRNA for hypothetical protein, partial cds, clone: RAAt1g26310.
GenBankATHDBD0.0L36925.1 Arabidopsis thaliana (clone pSK112) CAL gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006304696.10.0hypothetical protein CARUB_v10011954mg
SwissprotQ6R4S31e-162CAL_BRARR; Transcription factor CAULIFLOWER
SwissprotQ6R4S61e-162CAL_BRARC; Transcription factor CAULIFLOWER
TrEMBLR0I5P30.0R0I5P3_9BRAS; Uncharacterized protein
STRINGBra011021.1-P1e-160(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79225110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26310.11e-153MIKC_MADS family protein